Certified Moissanite Snowflake Necklace with Silver Chain

0
Sale price $126 Regular price $180
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Look cool even on the hottest day with our one and only sparkling Moissanite Pendant Necklace. While embracing the natures beauty of winter, it carries the meaning of uniqueness and rebirth. Capture the mesmerizing allure and symbolism with the Round Shape Certified Moissanite arranged in a cluster form in secure prong setting. Shine bright with the icy sparkle, this beauty is inspired by the frozen motif to make great symbolic jewelry for the one you care about. Give the outfit a dose of shine through this one-of-a-kind enchanted Snowflake Pendant that shines with strong and enchanting brilliance. This Statement Necklace is crafted in 14k white gold plated silver, sure to make an impression and showing it has power in beauty, which is majestic and cool. This radiant Winter Necklace suspends from a sturdy cable chain, giving your neckline a captivating look. It is the ideal birthday gift for her, a sweet Valentine’s Day surprise for your girlfriend, or a thoughtful Christmas present for mom - this Moissanite Snowflake Necklace is sure to light up their faces. It is versatile enough to complement any outfit, whether you are wearing a casual dress or a partywear gown. This Snowflake Jewelry is a timeless piece for your collection that will be cherished for years to come.

Product Information
SKU RCPE032013857-FBA
Length 15.7 mm
Width 9.9 mm
Weight 3.60 gm (Approximate)
Center Stone Weight 0.85 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 19 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-12 Pcs
Round-2.50X2.50 mm-1 Pcs
Round-2X2 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces